PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g027570.1
Common NameMTR_5g027570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 234aa    MW: 26545.7 Da    PI: 6.0533
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g027570.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.8e-1491137147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r  WT+ E++l++++++++G+g+Wk I++++  ++t+ q+ s+ qky
  Medtr5g027570.1  91 RVHWTEGEHKLFLEGIEKYGKGRWKDISKEFVVTKTPIQIASHAQKY 137
                      668*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.82486142IPR017930Myb domain
SuperFamilySSF466891.0E-1688142IPR009057Homeodomain-like
SMARTSM007172.2E-990140IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.4E-1890141IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.7E-1091136IPR009057Homeodomain-like
PfamPF002491.7E-1291137IPR001005SANT/Myb domain
CDDcd001673.60E-994138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MEGRKVQQLP HHIDLNERTS IQDPSENSME QQENLDTDVI ESGHAAAILN PNDNNSVQAE  60
SVPEGSNEAN LVQAESVPEG SHEAKRGRRE RVHWTEGEHK LFLEGIEKYG KGRWKDISKE  120
FVVTKTPIQI ASHAQKYFIH QNVKDIEKRK KRRSIHDTTL NKNGTLVTLA VEQDEIPSVE  180
QQSETPPQGM QQTQTQQNEI SPMLCLLFSI GSTIPDKEKL EKMRDLLAKE LRR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU9141280.0CU914128.2 Medicago truncatula chromosome 5 clone mth2-84e4, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003612667.11e-173myb-like DNA-binding domain protein
TrEMBLG7K8851e-173G7K885_MEDTR; Myb-like DNA-binding domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1691138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-26MYB family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]